SMART: Pfam domain TPPII

The domain within your query sequence starts at position 777 and ends at position 964; the E-value for the TPPII domain shown below is 2.4e-80.

SSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEV
TPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQ
ISDLDRLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSSSLTLPPKYNQPFFVTSLPD
DKIPKGAG

TPPII

PFAM accession number:	PF12580
Interpro abstract (IPR022229):	This entry represents a region of approximately 190 amino acids in length and is found in association with . The members are serine peptidases belonging to MEROPS peptidase family S8A, tripeptidyl peptidase II (TPPII), clan SB. They are a crucial component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. It is an amino peptidase belonging to the subtilase family removing tripeptides from the free N terminus of oligopeptides.

PFAM accession number:

PF12580

Interpro abstract (IPR022229):

This entry represents a region of approximately 190 amino acids in length and is found in association with . The members are serine peptidases belonging to MEROPS peptidase family S8A, tripeptidyl peptidase II (TPPII), clan SB. They are a crucial component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. It is an amino peptidase belonging to the subtilase family removing tripeptides from the free N terminus of oligopeptides.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPPII