The domain within your query sequence starts at position 108 and ends at position 250; the E-value for the TPP_enzyme_C domain shown below is 5.9e-8.
DLEGHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWE ALAFASHYNLDNLVAIFDVNRLGQSGTAPLEHCTAVYEKRCQAFGWNTYVVDGHDVEALC QAFWKAAQVKNKPTALIAKTFKG
TPP_enzyme_C |
---|
PFAM accession number: | PF02775 |
---|---|
Interpro abstract (IPR011766): | A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor. It has been shown [ (PUBMED:8604141) ] that some of these enzymes are structurally related. This represents the C-terminal TPP binding domain of TPP enzymes. |
GO function: | thiamine pyrophosphate binding (GO:0030976), catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPP_enzyme_C