The domain within your query sequence starts at position 17 and ends at position 185; the E-value for the TPP_enzyme_N domain shown below is 6.1e-46.

VSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYL
TGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRL
YTKFSARPSTIELIPFIIEKAVRSSIYGRPGACYIDIPADFVTLQANVT

TPP_enzyme_N

• PFAM accession number: PF02776
• Interpro abstract (IPR012001):

  A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor. It has been shown [ (PUBMED:8604141) ] that some of these enzymes are structurally related. This represents the N-terminal TPP binding domain of TPP enzymes.

• GO function: thiamine pyrophosphate binding (GO:0030976)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPP_enzyme_N