The domain within your query sequence starts at position 253 and ends at position 284; the E-value for the TPR_2 domain shown below is 5.4e-4.
AKALFRCGQACLLLTEYERARDFLVRAQKEQP
TPR_2 |
![]() |
---|
PFAM accession number: | PF07719 |
---|---|
Interpro abstract (IPR013105): | The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [ (PUBMED:7667876) (PUBMED:9482716) (PUBMED:1882418) ]. It mediates protein-protein interactions and the assembly of multiprotein complexes [ (PUBMED:14659697) ]. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding [ (PUBMED:22404999) ]. This repeat includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPR_2