The domain within your query sequence starts at position 1112 and ends at position 1240; the E-value for the TPR_MLP1_2 domain shown below is 5.1e-37.

KTLSTVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQ
AAKEQVSKMTSIRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNR
LLHDQIEKL

TPR_MLP1_2

 TPR_MLP1_2
PFAM accession number:PF07926
Interpro abstract (IPR012929):

This domain is found in a number of proteins, including TPR protein ( P12270 ) and yeast myosin-like protein 1 (MLP1, Q02455 ). These proteins share a number of features; for example, they have coiled-coil regions and are associated with nuclear pores [ (PUBMED:9024684) (PUBMED:7798308) (PUBMED:10085285) ]. TPR is thought to be a component of nuclear pore complex- attached intranuclear filaments [ (PUBMED:9024684) ], and is implicated in nuclear protein import [ (PUBMED:7798308) ]. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerisation of kinase domains or by targeting these kinases to the nuclear pore complex [ (PUBMED:7798308) ]. Mlp1 acts as a docking platform for for heterogeneous nuclear ribonucleoproteins that are required for mRNA export [ (PUBMED:12531921) ].

GO process:protein import into nucleus (GO:0006606)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPR_MLP1_2