The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the TP_methylase domain shown below is 1e-17.
MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREE VEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIM
TP_methylase |
---|
PFAM accession number: | PF00590 |
---|---|
Interpro abstract (IPR000878): | Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [ (PUBMED:11215515) ]. The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including cobalamin (vitamin B12), haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin [ (PUBMED:17227226) ]. These enzymes catalyse the methylation of their substrates using S-adenosyl-L-methionine as a methyl source. Enzymes in this family include:
This entry represents a tetrapyrrole methylase domain, which consist of two non-similar subdomains [ (PUBMED:15522295) ]. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP_methylase