The domain within your query sequence starts at position 1016 and ends at position 1245; the E-value for the TRAPPC10 domain shown below is 1.1e-45.
QEPPPPLHCQFSVGFSPASEEQLTVSLKPYTYEFQVENFFTLYSVRAEILPASGAEYCKT GSLCSLEVSITRLADLLDVDKDEALVESEDYFSTKLMYEVVDNSSNWAVCGKSCGVIAMP LAAQATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHASQLDADSWIENDSLSVDKHLD DQLDCSSLRSRGSTHSTSSSEHKGLPMPRLQALPAGQVFNSSTGMQVLVI
TRAPPC10 |
![]() |
---|
PFAM accession number: | PF12584 |
---|---|
Interpro abstract (IPR022233): | The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway. To date, two kinds of TRAPP complexes have been studied, TRAPPI and TRAPP II. These complexes differ in subunit composition [ (PUBMED:11239471) ]. TRAPP I binds vesicles derived from the endoplasmic reticulum bringing them closer to the acceptor membrane. This entry represents a domain which forms part of the TRAPP complex for mediating vesicle docking and fusion in the Golgi apparatus. The fungal version is referred to as Trs130, and an alternative vertebrate alias is TMEM1 [ (PUBMED:9564032) (PUBMED:11239471) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAPPC10