The domain within your query sequence starts at position 430 and ends at position 514; the E-value for the TRAUB domain shown below is 3.2e-29.
YHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKL LSFMAPIDHTAMSDDARTELFRSLF
TRAUB |
 |
|---|
| PFAM accession number: | PF08164 |
|---|---|
| Interpro abstract (IPR012617): | This C-terminal domain is found in apoptosis-antagonizing transcription factor (AATF) proteins [ (PUBMED:15112237) ]. This is the domain of the AATF proteins that interacts with BLOS2 or Ceap, that functions as an adaptor in processes such as protein and vesicle processing and transport, and perhaps transcription. |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRAUB