The domain within your query sequence starts at position 7 and ends at position 266; the E-value for the TRC8_N domain shown below is 1.2e-70.
LEAVLNVALRVPSIMLLDVLYRWDVSSFFQQIQRSSLNNNPLFQYKYLALNMHYVGYILS VVLLTLPRQHLVQLYLYFVTALLLYAGHQISRDYVRSELESAYEGPMYLEPLSMNRFTTA LIGQLVVCTLCSCVMKTKQIWLFSAHMLPLLARLCLVPLETIVIINKFAMIFTGLEVLYF LGSNLLVPYNLAKSAYRELVQVVEVYGLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSY FSTRDQPASRERLLFLFLTR
TRC8_N |
---|
PFAM accession number: | PF13705 |
---|---|
Interpro abstract (IPR025754): | This region is found at the N terminus of the TRC8 protein ( Q8WU17 ). TRC8 is an E3 ubiquitin-protein ligase also known as RNF139. This region contains 12 transmembrane domains and has been suggested to contain a sterol sensing domain [ (PUBMED:9689122) ]. It has been found that TRC8 protein levels are sterol responsive and that it binds and stimulates ubiquitylation of the endoplasmic reticulum anchor protein INSIG [ (PUBMED:20068067) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRC8_N