The domain within your query sequence starts at position 9 and ends at position 164; the E-value for the TRIC domain shown below is 3.1e-77.

YSVLSGAVAAAWNNPLASWLSAMLHCFGGGILSCMLLAESPLKFLTNHTNILLASSIWYI
VFFCPRDLVSQGYSYQPIQFLAAGMKEVTRTWKIVGGVSDANSYYRNAWIVMIVVGWARG
AGGAVVTACEQLLKGDWKPEGDEWLKMSFPCKITL

TRIC

TRIC
PFAM accession number:PF05197
Interpro abstract (IPR007866):

TRIC (trimeric intracellular cation) channels are differentially expressed in intracellular stores in animal cell types. TRIC subtypes contain three proposed transmembrane segments, and form homo-trimers with a bullet-like structure. Electrophysiological measurements with purified TRIC preparations identify a monovalent cation-selective channel [ (PUBMED:17611541) ].

GO process:monovalent inorganic cation transport (GO:0015672)
GO component:membrane (GO:0016020)
GO function:cation channel activity (GO:0005261)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRIC