The domain within your query sequence starts at position 595 and ends at position 684; the E-value for the TRM domain shown below is 6.8e-12.
TIDIYSAQGKRKSNEMAINLAKKQKTDASTAHPPFYYNIHRHSIKGMNMPKLKKFLCCLS QAGFRVSRTHFDPMGIRTDAPLMQFKSILL
TRM |
 |
|---|
| PFAM accession number: | PF02005 |
|---|---|
| Interpro abstract (IPR002905): | Trm1 ( EC 2.1.1.216 ) dimethylates a single guanine residue at position 26 of a number of tRNAs using S-adenosyl-L-methionine as donor of the methyl groups [ (PUBMED:9685492) (PUBMED:10438627) ]. In Saccharomyces cerevisiae, Trm1 is required for the modification of both mitochondrial and cytoplasmic tRNAs [ (PUBMED:2426253) ]. |
| GO process: | tRNA processing (GO:0008033) |
| GO function: | RNA binding (GO:0003723), tRNA (guanine-N2-)-methyltransferase activity (GO:0004809) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRM