The domain within your query sequence starts at position 165 and ends at position 285; the E-value for the TRM13 domain shown below is 3.4e-42.
KQQASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRFKV DGKHRKKDSVFERLQIDIQHLCLNRVPVLREGRLPVVGIGKHLCGVATGVTGDIMWAKSI S
TRM13 |
![]() |
---|
PFAM accession number: | PF05206 |
---|---|
Interpro abstract (IPR007871): | This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [ (PUBMED:17242307) ]. The alignment contains some conserved cysteines and histidines that might form a zinc binding site. |
GO process: | tRNA processing (GO:0008033) |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRM13