The domain within your query sequence starts at position 1194 and ends at position 1249; the E-value for the TRPM_tetra domain shown below is 3.3e-29.
EERIRVTFERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTL
TRPM_tetra |
 |
|---|
| PFAM accession number: | PF16519 |
|---|---|
| Interpro abstract (IPR032415): | This entry represents a short anti-parallel coiled-coil tetramerisation domain of the transient receptor potential cation channel subfamily M member proteins 1-8. It is held together by extensive core packing and interstrand polar interactions. Transient receptor potential (TRP) channels comprise a large family of tetrameric cation-selective ion channels that respond to diverse forms of sensory input. The presence of cytoplasmic domains that direct channel assembly appears to be a feature of many voltage-gated ion channel superfamily members [ (PUBMED:18782578) ]. |
| GO process: | protein tetramerization (GO:0051262) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRPM_tetra