The domain within your query sequence starts at position 992 and ends at position 1048; the E-value for the TSC22 domain shown below is 7e-31.
MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQ
TSC22 |
![]() |
---|
PFAM accession number: | PF01166 |
---|---|
Interpro abstract (IPR000580): | Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation. These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Proteins containing this signature include:
|
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSC22