The domain within your query sequence starts at position 90 and ends at position 196; the E-value for the TSSC4 domain shown below is 4.8e-30.
SHSIFDCLESAARQAPCSAPQTSVSDNGSFRRPVTPPSQTPARGLSRVHGNTGPTRVLPV PDYVSHPERWTKYSLEDVSEASEQSNRDAALAFLSSRSQVSHTDYVP
TSSC4 |
---|
PFAM accession number: | PF15264 |
---|---|
Interpro abstract (IPR029338): | The TSSC4 (for tumor-suppressing STF cDNA 4) gene is located in the centre of a 1 Mb gene cluster which contains several imprinted genes; however in humans the TSSC4 gene is not imprinted [ (PUBMED:9403053) (PUBMED:10072438) ]. This same cluster is associated with the Beckwith-Wiedermann syndrome [ (PUBMED:10915772) ]. Proteins in the TSSC4 family are found in eukaryotes, and contain a conserved YSL sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSSC4