The domain within your query sequence starts at position 35 and ends at position 115; the E-value for the Takusan domain shown below is 2.2e-25.
KTSSQNCNITNHMKNMNKLEDMKFYIRKIHAERVELFLILDIEMNTDLNYRMNIEFTIIK SQHEKKMLDMEKMMQSISDTI
Takusan |
![]() |
---|
PFAM accession number: | PF04822 |
---|---|
Interpro abstract (IPR006907): | This domain is found in an number of proteins, including Disks large homologue 5 and members of the takusan gene family [ (PUBMED:17610818) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Takusan