SMART: Pfam domain Tantalus

The domain within your query sequence starts at position 158 and ends at position 193; the E-value for the Tantalus domain shown below is 1.2e-15.

LTPMGLPRPKRLKKKEFSLEEIYTNKNYKSPPASSP

Tantalus

PFAM accession number:	PF15386
Interpro abstract (IPR028149):	This entry consist of an alpha+beta fold domain found in metazoan proteins such as tantalus from Drosophila [ (PUBMED:22186017) ]. Tantalus is a potential cofactor involved in sensory organ development. It binds the chromatin protein additional sex combs (Asx) and also binds DNA in vitro [ (PUBMED:11397012) ]. Proteins containing this domain also include proline-rich protein 14 (PRR14) and related proteins from mammals.

PFAM accession number:

PF15386

Interpro abstract (IPR028149):

This entry consist of an alpha+beta fold domain found in metazoan proteins such as tantalus from Drosophila [ (PUBMED:22186017) ]. Tantalus is a potential cofactor involved in sensory organ development. It binds the chromatin protein additional sex combs (Asx) and also binds DNA in vitro [ (PUBMED:11397012) ]. Proteins containing this domain also include proline-rich protein 14 (PRR14) and related proteins from mammals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tantalus