The domain within your query sequence starts at position 84 and ends at position 241; the E-value for the Taxilin domain shown below is 3.6e-54.
KTLGKEVLLLMQALNTLSTPEEKLAALCKKYADLLEESRNVQKQMKILQKKQAQIVKEKV HLQSEHSKAILARSKLESLCRELQRHNKTLKEENMQQAREEEERRKEATAHFQITLNEIQ AQLEQHDIHNAKLRQENIELGEKLKKLIEQYALREEVI
Taxilin |
---|
PFAM accession number: | PF09728 |
---|---|
Interpro abstract (IPR026183): | The taxilin family of proteins includes alpha-, beta- and gamma-taxilins. They bind to members of the syntaxin protein family [ (PUBMED:15184072) ], which are implicated in intracellular vesicle traffic. Taxilins might therefore be involved in this process. Alpha-taxilin may also be involved in calcium-dependent exocytosis in neuroendocrine cells [ (PUBMED:12558796) ], while gamma-taxilin (also known as Elrg) may have a role in cell cycle progression [ (PUBMED:18068885) ]. |
GO function: | syntaxin binding (GO:0019905) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Taxilin