The domain within your query sequence starts at position 263 and ends at position 437; the E-value for the Tcp10_C domain shown below is 1.3e-83.
ERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKIKSNQKVIYYYADAQTMHTTY PDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKRLKDGCEETVFPDGTFVTVKRNGDKTI MFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVKDEKGTVILDW
Tcp10_C |
![]() |
---|
PFAM accession number: | PF07202 |
---|---|
Interpro abstract (IPR009852): | This entry represents a C-terminal domain found in members of the T complex protein 10 family. This domain contains unusual G repeats [ (PUBMED:11003675) ]. Centromere protein J, a member of the TCP10 family, inhibits microtubule nucleation from the centrosome and depolymerises taxol-stabilised microtubules [ (PUBMED:12068715) ]. T-complex is involved in spermatogenesis in mice [ (PUBMED:15047868) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tcp10_C