The domain within your query sequence starts at position 118 and ends at position 178; the E-value for the Tctex-1 domain shown below is 1.3e-9.

AAGAQRALEAALTTQLNGVCYCGSEAGKLVQALCEQIHTRVRELNLPRYKLVCNVVLGPR
E

Tctex-1

Tctex-1
PFAM accession number:PF03645
Interpro abstract (IPR005334):

Tctex-1 is a dynein light chain. Dynein translocates rhodopsin-bearing vesicles along microtubules and it has been shown that Tctex-1 can bind to the cytoplasmic tail of rhodopsin. An efficient vectorial transport system must be required to deliver large numbers of newly synthesized rhodopsin molecules (~10 7 molecules per day per photoreceptor) to the base of the outer segment of the photoreceptor, Tctex-1 may well play a role in this process. C-terminal rhodopsin mutations responsible for retinitis pigmentosa inhibit the interaction between Tctex-1 and rhodopsin, which may be the molecular basis of retinitis pigmentosa [ (PUBMED:10399916) ].

In the mouse, the chromosomal location and pattern of expression of Tctex-1 make it a candidate for involvement in male sterility [ (PUBMED:2570638) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tctex-1