The domain within your query sequence starts at position 74 and ends at position 171; the E-value for the Tctex-1 domain shown below is 9.8e-28.
TVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDD QSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVY
Tctex-1 |
![]() |
---|
PFAM accession number: | PF03645 |
---|---|
Interpro abstract (IPR005334): | Tctex-1 is a dynein light chain. Dynein translocates rhodopsin-bearing vesicles along microtubules and it has been shown that Tctex-1 can bind to the cytoplasmic tail of rhodopsin. An efficient vectorial transport system must be required to deliver large numbers of newly synthesized rhodopsin molecules (~10 7 molecules per day per photoreceptor) to the base of the outer segment of the photoreceptor, Tctex-1 may well play a role in this process. C-terminal rhodopsin mutations responsible for retinitis pigmentosa inhibit the interaction between Tctex-1 and rhodopsin, which may be the molecular basis of retinitis pigmentosa [ (PUBMED:10399916) ]. In the mouse, the chromosomal location and pattern of expression of Tctex-1 make it a candidate for involvement in male sterility [ (PUBMED:2570638) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tctex-1