The domain within your query sequence starts at position 513 and ends at position 621; the E-value for the Telomere_reg-2 domain shown below is 3.8e-38.
PLYIRDCVEALTTSEDMERWEASLKGLEGLVYRSPTATREVSVELAKVLLHLEEKTCVAE FEQLRQSALVAVTVTDPEQVAKYLTSQFYGLNYSLRQRMDILDVLVLAA
Telomere_reg-2 |
 |
|---|
| PFAM accession number: | PF10193 |
|---|---|
| Interpro abstract (IPR019337): | This entry represents a conserved domain found in a group of proteins called telomere-length regulation, or clock abnormal protein-2, which are conserved from plants to humans. These proteins regulate telomere length and contribute to silencing of sub-telomeric regions [ (PUBMED:11641227) ]. In vitro the protein binds to telomeric DNA repeats. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Telomere_reg-2