The domain within your query sequence starts at position 3 and ends at position 79; the E-value for the ThiI domain shown below is 7.7e-8.
ALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQ ILDIPFHQVSYVKEYWN
ThiI |
![]() |
---|
PFAM accession number: | PF02568 |
---|---|
Interpro abstract (IPR020536): | Three domains of ThiI are essential for the thiolation of tRNA: a THUMP domain that binds tRNA (see IPR004114 ) [ (PUBMED:16343540) ], an AANH domain that activates the uridine residue by adenylylation [ (PUBMED:18604845) ], and a rhodanese domain that transfers sulfur to the activated uridine residue [ (PUBMED:11443125) ]. Neither the THUMP nor the AANH domain of ThiI are essential for thiamine synthesis, only the rhodanese domain is necessary for synthesis of the thiazole moiety of thiamine [ (PUBMED:21724998) ]. tRNA sulfurtransferase ThiI catalyses the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor [ (PUBMED:11443125) (PUBMED:16855700) (PUBMED:18604845) ]. In some bacteria, ThiI is a bifunctional enzyme required for the synthesis of both the 4-thiouridine modification in tRNA and the thiazole moiety in the thiamine biosynthesis pathway [ (PUBMED:9209060) ]. This entry represents the AANH domain. |
GO function: | tRNA adenylyltransferase activity (GO:0004810) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ThiI