The domain within your query sequence starts at position 3 and ends at position 79; the E-value for the ThiI domain shown below is 7.7e-8.

ALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQ
ILDIPFHQVSYVKEYWN

ThiI

ThiI
PFAM accession number:PF02568
Interpro abstract (IPR020536):

Three domains of ThiI are essential for the thiolation of tRNA: a THUMP domain that binds tRNA (see IPR004114 ) [ (PUBMED:16343540) ], an AANH domain that activates the uridine residue by adenylylation [ (PUBMED:18604845) ], and a rhodanese domain that transfers sulfur to the activated uridine residue [ (PUBMED:11443125) ]. Neither the THUMP nor the AANH domain of ThiI are essential for thiamine synthesis, only the rhodanese domain is necessary for synthesis of the thiazole moiety of thiamine [ (PUBMED:21724998) ].

tRNA sulfurtransferase ThiI catalyses the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor [ (PUBMED:11443125) (PUBMED:16855700) (PUBMED:18604845) ]. In some bacteria, ThiI is a bifunctional enzyme required for the synthesis of both the 4-thiouridine modification in tRNA and the thiazole moiety in the thiamine biosynthesis pathway [ (PUBMED:9209060) ].

This entry represents the AANH domain.

GO function:tRNA adenylyltransferase activity (GO:0004810)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ThiI