The domain within your query sequence starts at position 2 and ends at position 81; the E-value for the Thr_synth_N domain shown below is 1.1e-27.
WYTSTRGMAPRVNFEGALFSGYAPDGGLYMPEELPRLDEETLRHWSTLSYRSLVKELCAL FIGLELIPRHDLNDLIDRAF
Thr_synth_N |
![]() |
---|
PFAM accession number: | PF14821 |
---|---|
Interpro abstract (IPR029144): | This domain is found at the N terminus of many threonine synthase enzymes [ (PUBMED:11756443) ]. Threonine synthases catalyses the gamma-elimination of phosphate from L-phosphohomoserine and the beta-addition of water to produce L-threonine [ (PUBMED:8074505) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thr_synth_N