The domain within your query sequence starts at position 1 and ends at position 95; the E-value for the Tmemb_161AB domain shown below is 5.1e-41.
AVLGVQLVVTLFTATLMHRLAPHCSFARWLLCNGSLFRYIHPSEEELRALSGKLRPRVRK ERWANGLHDEKPLSVPRDAHFQLQTCPLTAVDALE
Tmemb_161AB |
![]() |
---|
PFAM accession number: | PF10268 |
---|---|
Interpro abstract (IPR019395): | This entry represents a family of conserved eukaryotic proteins. Members are putative transmembrane proteins but otherwise the function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_161AB