The domain within your query sequence starts at position 30 and ends at position 132; the E-value for the Tmemb_170 domain shown below is 3.9e-42.
NLTEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVISIIAVSIGFLASVTGAMIT SAAVAGIYRVAGKNMAPLEALVWGVGQTVLTLIISFSRILATL
Tmemb_170 |
---|
PFAM accession number: | PF10190 |
---|---|
Interpro abstract (IPR019334): | This entry represents a group of putative transmembrane proteins. The protein is only approximately 130 amino acids in length. The function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_170