The domain within your query sequence starts at position 25 and ends at position 131; the E-value for the Tmemb_185A domain shown below is 7.4e-17.

LKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAM
LLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGALTELGYNVFFV

Tmemb_185A

Tmemb_185A
PFAM accession number:PF10269
Interpro abstract (IPR019396):

This entry represents conserved transmembrane proteins that in humans are expressed from a region upstream of the FragileXF site and appear to be intimately linked with Fragile-X syndrome. The absence of the human TMEM185A protein does not necessarily lead to developmental delay, but might, in combination with other, currently unknown, factors. Alternatively, the TMEM185A protein is either redundant, or its function can be complemented by the highly similar chromosome 2 retro-pseudogene product, TMEM185B [ (PUBMED:12404111) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_185A