The domain within your query sequence starts at position 5 and ends at position 122; the E-value for the Tmemb_18A domain shown below is 1.6e-61.
EQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSL WNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRP
Tmemb_18A |
---|
PFAM accession number: | PF09771 |
---|---|
Interpro abstract (IPR019168): | Nuclear envelope phosphatase 1-regulatory subunit 1 (NEP1-R1), formerly known as TMEM188, functions in the lipin activation pathway [ (PUBMED:22134922) ]. NEP1R1 forms a complex with the phosphatase CTDNEP1. The complex dephosphorylates and may activate phosphatidate phosphatases Lipin-1 and -2, which catalyse the conversion of phosphatidic acid to diacylglycerol. |
GO process: | positive regulation of protein dephosphorylation (GO:0035307) |
GO component: | Nem1-Spo7 phosphatase complex (GO:0071595) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_18A