The domain within your query sequence starts at position 32 and ends at position 162; the E-value for the Tmemb_40 domain shown below is 6.5e-57.
YEDIGSSRVRYWDLLLLIPNVLFFIFLLWKLPLARAKIRVTSSPIFITFYILVFVVALVG IARAVVSMTVSASDAATVADKILWEITRFFLLAIELSVIILGLAFGHLESKSSIKRVLAI TTVLSLAYSVT
Tmemb_40 |
---|
PFAM accession number: | PF10160 |
---|---|
Interpro abstract (IPR018781): | This family of membrane proteins are conserved from plants to humans, including CAND2 and CAND8 from Arabidopsis. CAND2 and CAND8 are predicted G-protein coupled receptors [ (PUBMED:18671868) ]. CAND2 plays a role in plants and microbes interactions [ (PUBMED:22206669) ] and acts as a phytomelatonin receptor that regulates stomatal closure through the Galpha subunit-mediated H2O2 production and Ca2 flux dynamics [ (PUBMED:29702752) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_40