The domain within your query sequence starts at position 55 and ends at position 198; the E-value for the Tmemb_9 domain shown below is 6e-59.

GHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILG
LLLLYMVYLTLVEPILKRRLFGHSQLLQSDDDVGDHQPFANAHDVLARSRSRANVLNKVE
YAQQRWKLQVQEQRKSVFDRHVVL

Tmemb_9

Tmemb_9
PFAM accession number:PF05434
Interpro abstract (IPR008853):

This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 . The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to H. sapiens and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localised to the late endosomes and lysosomes [ (PUBMED:12359240) ]. Members of this family contain CXCXC repeats IPR004153 in their N-terminal region.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_9