The domain within your query sequence starts at position 46 and ends at position 151; the E-value for the Tmemb_cc2 domain shown below is 1.3e-28.
RNVREGVKHRIFYLSEQLRVEKASRDENTMSYLKLVSKADRHQAPHIRKAFERVNQRTSA TIAHIERKLYQCHQQLKELEEGCSPTSSVLKVGSGLDSHKQPSGKV
Tmemb_cc2 |
---|
PFAM accession number: | PF10267 |
---|---|
Interpro abstract (IPR019394): | This entry includes testis-specific TEX28 and transmembrane and coiled-coil domains protein 1/2/3 (TMCC1/2/3). TMCC1 is an ER protein. Overexpression of TMCC1 or its transmembrane domains has been shown to cause defects in ER morphology [ (PUBMED:24454821) ]. The Drosophila TMCC2 is an an amyloid protein precursor-interacting and apolipoprotein E-binding protein. It is required for normal development of the brain [ (PUBMED:23409049) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_cc2