The domain within your query sequence starts at position 47 and ends at position 134; the E-value for the Tmemb_cc2 domain shown below is 3.3e-44.

VTEQIKIEQTSRDGNVAEYLKLVSSADKQQAGRIKQVFEKKNQKSAHSIAQLQKKLEQYH
RKLREIEQNGVTR

Tmemb_cc2

Tmemb_cc2
PFAM accession number:PF10267
Interpro abstract (IPR019394):

This entry includes testis-specific TEX28 and transmembrane and coiled-coil domains protein 1/2/3 (TMCC1/2/3). TMCC1 is an ER protein. Overexpression of TMCC1 or its transmembrane domains has been shown to cause defects in ER morphology [ (PUBMED:24454821) ].

The Drosophila TMCC2 is an an amyloid protein precursor-interacting and apolipoprotein E-binding protein. It is required for normal development of the brain [ (PUBMED:23409049) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_cc2