The domain within your query sequence starts at position 46 and ends at position 121; the E-value for the Tmp39 domain shown below is 6.8e-32.
TSGTGLSSPPLAAQTVVPLQHCKIPELPVQASILFELQLFFCQLIALFVHYINIYKTVWW YPPSHPPSHTSLVISW
Tmp39 |
 |
|---|
| PFAM accession number: | PF10271 |
|---|---|
| Interpro abstract (IPR019397): | This is a family of putative, eukaryote, transmembrane proteins but the function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmp39