The domain within your query sequence starts at position 17 and ends at position 71; the E-value for the Tmpp129 domain shown below is 1e-24.
VCFVFTPNEFYSAGLTVQNLLSGWLGSEDAAFVPYHLRRTSATLLCHSLLPLGEP
Tmpp129 |
---|
PFAM accession number: | PF10272 |
---|---|
Interpro abstract (IPR018801): | TM129 (also known as TMEM129) is a tri-spanning ER-membrane protein that can serve as an E3 ligase involved in ER-associated protein degradation [ (PUBMED:27854284) (PUBMED:24807418) ]. |
GO process: | protein ubiquitination (GO:0016567) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | ubiquitin protein ligase activity (GO:0061630) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmpp129