The domain within your query sequence starts at position 151 and ends at position 219; the E-value for the Tom37 domain shown below is 4.2e-21.

LFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSDGKVITV
PHKIITHLR

Tom37

 Tom37
PFAM accession number:PF10568
Interpro abstract (IPR019564):

Sam37 (also known as TOM37) is a component of the mitochondrial outer membrane sorting assembly machinery (SAM or TOB) complex, which is required for the sorting of proteins with complicated topology, such as beta-barrel proteins, to the mitochondrial outer membrane after import by the TOM complex [ (PUBMED:12891361) ]. It has homology with Metaxin-1, also part of the outer mitochondrial membrane beta-barrel protein transport complex [ (PUBMED:17981999) (PUBMED:9045676) ].

GO component:SAM complex (GO:0001401)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tom37