The domain within your query sequence starts at position 9 and ends at position 53; the E-value for the Tom7 domain shown below is 5.3e-19.
KQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVLSLL
Tom7 |
![]() |
---|
PFAM accession number: | PF08038 |
---|---|
Interpro abstract (IPR012621): | This family consists of mitochondrial import receptor subunit TOM7. TOM7 forms part of the translocase of the outer mitochondrial membrane (TOM) complex and it appears to function as a modulator of the dynamics of the mitochondrial protein transport machinery by promoting the dissociation of subunits of the outer membrane translocase [ (PUBMED:9642296) ]. |
GO process: | protein import into mitochondrial matrix (GO:0030150) |
GO component: | mitochondrial outer membrane translocase complex (GO:0005742) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tom7