The domain within your query sequence starts at position 58 and ends at position 293; the E-value for the Transcrip_reg domain shown below is 1.1e-64.
NKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNSSLANILELCRSKNMPKS TIESALKTEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLDIKYILNKNGGMMAEGAR HFFDKKGVVVVGVEDREKKAVNLERALELAIEAGAEDVKEAEDEEEKNLFKFICDASSLH QVRKKLDSLGLCPVSCSMEFIPHSKVQLAEPELEQAAHLIQALNNYEDVIHVYDNI
Transcrip_reg |
---|
PFAM accession number: | PF01709 |
---|---|
Interpro abstract (IPR002876): | This is a family of transcriptional regulators. In mammals, TACO1 ( Q9BSH4 ) activates the transcription of mitochondrially-encoded cytochrome c oxidase (COX1). Defects in TACO1 are a cause of Leigh syndrome (LS). LS is a severe neurological disorder characterised by bilaterally symmetrical necrotic lesions in subcortical brain regions that is commonly associated with systemic cytochrome c oxidase (COX) deficiency [ (PUBMED:19503089) ]. In Pseudomonas aeruginosa, a member of this family, PmpR, is involved in regulation of the quinolone signal (PQS) system and of pyocyanine production. It negatively regulates the quorum-sensing response regulator pqsR of the PQS system by binding to its promoter region [ (PUBMED:18641136) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transcrip_reg