The domain within your query sequence starts at position 226 and ends at position 289; the E-value for the Troponin domain shown below is 1.2e-9.

HLNEDQLREKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAK
VTGR

Troponin

Troponin
PFAM accession number:PF00992
Interpro abstract (IPR001978):

The troponin (Tn) complex regulates Ca 2+ induced muscle contraction. Tn contains three subunits, Ca 2+ binding (TnC), inhibitory (TnI), and tropomyosin binding (TnT). This family includes troponin T and troponin I. Troponin I binds to actin and troponin T binds to tropomyosin [ (PUBMED:3102969) (PUBMED:7852318) (PUBMED:7601340) ].

GO component:troponin complex (GO:0005861)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Troponin