The domain within your query sequence starts at position 238 and ends at position 300; the E-value for the Troponin domain shown below is 4.3e-9.
LNEDQLREKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKV TGR
Troponin |
---|
PFAM accession number: | PF00992 |
---|---|
Interpro abstract (IPR001978): | The troponin (Tn) complex regulates Ca 2+ induced muscle contraction. Tn contains three subunits, Ca 2+ binding (TnC), inhibitory (TnI), and tropomyosin binding (TnT). This family includes troponin T and troponin I. Troponin I binds to actin and troponin T binds to tropomyosin [ (PUBMED:3102969) (PUBMED:7852318) (PUBMED:7601340) ]. |
GO component: | troponin complex (GO:0005861) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Troponin