The domain within your query sequence starts at position 1 and ends at position 32; the E-value for the Troponin-I_N domain shown below is 1.1e-14.

MADESSDAAGEPQPAPAPVRRRSSANYRAYAT

Troponin-I_N

 Troponin-I_N
PFAM accession number:PF11636
Interpro abstract (IPR021666):

This family of proteins represents the cardiac N-extension of troponin I. This region of the protein (1-32) interacts with the N-lobe of cTnC and modulates myofilament calcium(2) sensitivity [ (PUBMED:17854829) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Troponin-I_N