The domain within your query sequence starts at position 555 and ends at position 903; the E-value for the Tuberin domain shown below is 5.9e-149.
ASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQA FDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVP MGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLS SALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQ GLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLP HLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLP
Tuberin |
![]() |
---|
PFAM accession number: | PF03542 |
---|---|
Interpro abstract (IPR018515): | Initiation of eukaryotic mRNA transcription requires melting of promoter DNA with the help of the general transcription factors TFIIE and TFIIH. In higher eukaryotes, the general transcription factor TFIIE consists of two subunits: the large alpha subunit ( IPR002853 ) and the small beta ( IPR003166 ). TFIIE beta has been found to bind to the region where the promoter starts to open to be single-stranded upon transcription initiation by RNA polymerase II. The approximately 120-residue central core domain of TFIIE beta plays a role in double-stranded DNA binding of TFIIE [ (PUBMED:10716934) ]. The TFIIE beta central core DNA-binding domain consists of three helices with a beta hairpin at the C terminus, resembling the winged helix proteins. It shows a novel double-stranded DNA-binding activity where the DNA-binding surface locates on the opposite side to the previously reported winged helix motif by forming a positively charged furrow [ (PUBMED:10716934) ]. This domain is found in Tuberin proteins. |
GO process: | positive regulation of GTPase activity (GO:0043547) |
GO function: | GTPase activator activity (GO:0005096) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tuberin