The domain within your query sequence starts at position 450 and ends at position 537; the E-value for the UAE_UbL domain shown below is 5.6e-27.
VRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNPKKLSDFGI RNGSRLQADDFLQDYTLLINILHSEDLG
UAE_UbL |
---|
PFAM accession number: | PF14732 |
---|---|
Interpro abstract (IPR028077): | This is the C-terminal domain of ubiquitin-activating enzyme and SUMO-activating enzyme 2. It is structurally similar to ubiquitin. This domain is involved in E1-SUMO-thioester transfer to the SUMO E2 conjugating protein [ (PUBMED:15660128) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UAE_UbL