The domain within your query sequence starts at position 25 and ends at position 129; the E-value for the UBD domain shown below is 2.9e-40.
RNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHE LAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLE
UBD |
![]() |
---|
PFAM accession number: | PF16455 |
---|---|
Interpro abstract (IPR032752): | This domain can be found in the N terminus of DC-UbP/UBTD2. It has a novel structural fold and acts as a Ub-binding domain (UBD) but with low affinity [ (PUBMED:20440844) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBD