The domain within your query sequence starts at position 192 and ends at position 271; the E-value for the UBX domain shown below is 3.8e-16.

ETAEEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYHKSLYRLSNSFPRRALEVE
GGSSLEDIGITVDTVLNVEE

UBX

 UBX
PFAM accession number:PF00789
Interpro abstract (IPR001012):

The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast. The function of the UBX domain is not known although the fragment of avian FAF-1 containing the UBX domain causes apoptosis of transfected cells.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBX