SMART: Pfam domain UBZ

The domain within your query sequence starts at position 124 and ends at position 158; the E-value for the UBZ_FAAP20 domain shown below is 2.6e-23.

LLSCPLCQKAFDPKLTQLDVDSHLAQCLAECTEDV

UBZ_FAAP20

PFAM accession number:	PF15750
Interpro abstract (IPR031490):	This domain is the type 2 UBZ found in Fanconi anemia-associated protein of 20kDa (FAAP20) [ (PUBMED:22343915) (PUBMED:22266823) (PUBMED:22396592) (PUBMED:22705371) ]. The ubiquitin-binding zinc finger (UBZ) is a type of zinc-coordinating beta- beta-alpha fold domain found mainly in proteins involved in DNA repair and transcriptional regulation. UBZ domains coordinate a zinc ion with cysteine or histidine residues; depending on their amino acid sequence, UBZ domains are classified into several families [ (PUBMED:19213613) (PUBMED:27062441) ]. Type 1 UBZs are CCHH-type zinc fingers found in tandem UBZ domains of TAX1-binding protein 1 (TAX1BP1) [ (PUBMED:24239949) (PUBMED:26506893) (PUBMED:27370208) ], type 2 UBZs are CCHC-type zinc fingers found in FAAP20 which is a subunit of the Fanconi anemia (FA) core complex [ (PUBMED:25414354) (PUBMED:25799058) ], type 3 UBZs are CCHH-type zinc fingers found only in the Y-family translesion polymerase eta [ (PUBMED:17304240) (PUBMED:17550419) (PUBMED:20837403) ], and type 4 UBZs are CCHC-type zinc fingers found in Y-family translesion polymerase kappa, Werner helicase-interacting protein 1 (WRNIP1), and Rad18 [ (PUBMED:20385554) (PUBMED:25162118) (PUBMED:24794496) ]. The UBZ domain consists of two short antiparallel beta-strands followed by one alpha-helix. The alpha-helix packs against the beta-strands with a zinc ion sandwiched between the alpha-helix and the beta-strands. The zinc ion is coordinated by two cysteines located on the fingertip formed by the beta- strands and two histidines [ (PUBMED:19213613) (PUBMED:17304240) ] or one hisidine and one cysteine [ (PUBMED:25414354) ] on the alpha-helix [ (PUBMED:27062441) ].
GO function:	ubiquitin binding (GO:0043130)

PFAM accession number:

PF15750

Interpro abstract (IPR031490):

This domain is the type 2 UBZ found in Fanconi anemia-associated protein of 20kDa (FAAP20) [ (PUBMED:22343915) (PUBMED:22266823) (PUBMED:22396592) (PUBMED:22705371) ].

The ubiquitin-binding zinc finger (UBZ) is a type of zinc-coordinating beta- beta-alpha fold domain found mainly in proteins involved in DNA repair and transcriptional regulation. UBZ domains coordinate a zinc ion with cysteine or histidine residues; depending on their amino acid sequence, UBZ domains are classified into several families [ (PUBMED:19213613) (PUBMED:27062441) ]. Type 1 UBZs are CCHH-type zinc fingers found in tandem UBZ domains of TAX1-binding protein 1 (TAX1BP1) [ (PUBMED:24239949) (PUBMED:26506893) (PUBMED:27370208) ], type 2 UBZs are CCHC-type zinc fingers found in FAAP20 which is a subunit of the Fanconi anemia (FA) core complex [ (PUBMED:25414354) (PUBMED:25799058) ], type 3 UBZs are CCHH-type zinc fingers found only in the Y-family translesion polymerase eta [ (PUBMED:17304240) (PUBMED:17550419) (PUBMED:20837403) ], and type 4 UBZs are CCHC-type zinc fingers found in Y-family translesion polymerase kappa, Werner helicase-interacting protein 1 (WRNIP1), and Rad18 [ (PUBMED:20385554) (PUBMED:25162118) (PUBMED:24794496) ].

The UBZ domain consists of two short antiparallel beta-strands followed by one alpha-helix. The alpha-helix packs against the beta-strands with a zinc ion sandwiched between the alpha-helix and the beta-strands. The zinc ion is coordinated by two cysteines located on the fingertip formed by the beta- strands and two histidines [ (PUBMED:19213613) (PUBMED:17304240) ] or one hisidine and one cysteine [ (PUBMED:25414354) ] on the alpha-helix [ (PUBMED:27062441) ].

GO function:

ubiquitin binding (GO:0043130)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBZ_FAAP20