The domain within your query sequence starts at position 503 and ends at position 689; the E-value for the UCH_1 domain shown below is 5.2e-13.
VEWDSSVTERLFGSLQEERVQDADSVWRQQQAHQQPSCTLDECFQSYTKEEQLAQDDAWK CPHCQVLQQGVVKLSLWTLPDILIIHLKRFCQVGERRNKLSTLVKFPLSGLNMAPHVARR STNSKAGPGPWSSWKQPICLPTTYPLDFLYDLYAVCNHHGSLQGGHYTAYCRNSLDGQWY SYDDSTV
UCH_1 |
![]() |
---|
PFAM accession number: | PF13423 |
---|---|
Interpro abstract (IPR028881): | This entry represents a domain found in PAN2. The poly(A)-specific nuclease (PAN) is a deadenylating enzyme involved in cytoplasmic mRNA turnover. Both yeast and mammalian PAN have been shown to contain two subunits, PAN2 and PAN3; PAN2 is the catalytic subunit [ (PUBMED:8550599) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCH_1