The domain within your query sequence starts at position 1 and ends at position 55; the E-value for the UCR_6-4kD domain shown below is 1.2e-36.
MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKD
UCR_6-4kD |
 |
|---|
| PFAM accession number: | PF08997 |
|---|---|
| Interpro abstract (IPR015089): | The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is an essential component of the mitochondrial cellular respiratory chain. This family represents the 6.4kDa protein, which may be closely linked to the iron-sulphur protein in the complex and function as an iron-sulphur protein-binding factor [ (PUBMED:15312779) ]. |
| GO function: | ubiquinol-cytochrome-c reductase activity (GO:0008121), electron transfer activity (GO:0009055) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCR_6-4kD