The domain within your query sequence starts at position 8 and ends at position 60; the E-value for the UCR_UQCRX_QCR9 domain shown below is 9e-30.
SRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
UCR_UQCRX_QCR9 |
 |
|---|
| PFAM accession number: | PF05365 |
|---|---|
| Interpro abstract (IPR008027): | Cytochrome b-c1 complex subunit 9 (QCR9) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. It may interact with cytochrome c1 [ (PUBMED:2174427) (PUBMED:1332881) ]. QCR9 contains the single transmembrane helix structure. |
| GO process: | mitochondrial electron transport, ubiquinol to cytochrome c (GO:0006122) |
| GO component: | mitochondrial respiratory chain complex III (GO:0005750), mitochondrial inner membrane (GO:0005743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCR_UQCRX_QCR9