The domain within your query sequence starts at position 25 and ends at position 89; the E-value for the UCR_hinge domain shown below is 2e-29.
VDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKL FKNLK
UCR_hinge |
![]() |
---|
PFAM accession number: | PF02320 |
---|---|
Interpro abstract (IPR023184): | The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is a respiratory multienzyme complex [ (PUBMED:9651245) ]. The bc1 complex contains 11 subunits; 3 respiratory subunits (cytochrome B, cytochrome C1, Rieske protein), 2 core proteins and 6 low molecular weight proteins. This family represents the 'hinge' protein of the complex which is thought to mediate formation of the cytochrome c1 and cytochrome c complex. Proteins in this entry from an alpha-helical hairpin. This entry represents the structural domain found in these proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCR_hinge