The domain within your query sequence starts at position 23 and ends at position 92; the E-value for the UMP1 domain shown below is 3.4e-18.

GPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQME
FKAVQQIHHK

UMP1

UMP1
PFAM accession number:PF05348
Interpro abstract (IPR008012):

Ump1 is a short-lived chaperone present in the precursor form of the 20S proteasome and absent in the mature complex. Ump1 is required for the correct assembly and enzymatic activation of the proteasome. Ump1 seems to be degraded by the proteasome upon its formation [ (PUBMED:9491890) (PUBMED:17431397) ].

GO process:proteasome assembly (GO:0043248)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UMP1